Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.35
PubTator Score 7.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Malaria 160 4.014 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.115 1.6e-02
lung adenocarcinoma 1.120 1.4e-04
lung cancer 1.700 4.0e-04
non-small cell lung cancer 1.246 1.3e-20
ovarian cancer 1.300 1.6e-03
pituitary cancer 1.300 1.9e-02
posterior fossa group A ependymoma 1.100 1.1e-05
psoriasis -1.200 1.0e-02

Gene RIF (6)

AA Sequence

MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAK      1 - 70
ESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKG     71 - 140
NKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAA    141 - 210
RFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQ    211 - 280
QAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYS    281 - 350
KAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI    351 - 420
DNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSD    421 - 490
TPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLK    491 - 560
SSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMF    561 - 630
MSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG                                       631 - 665
//

Text Mined References (37)

PMID Year Title