Property Summary

NCBI Gene PubMed Count 19
PubMed Score 31.80
PubTator Score 7.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.33484505702163E-20
posterior fossa group B ependymoma 1530 2.47182498851641E-5
pituitary cancer 1972 2.76532417827757E-5
lung adenocarcinoma 2714 1.40853335534452E-4
lung cancer 4473 3.97323983358198E-4
ovarian cancer 8492 0.00157731858460287
psoriasis 6685 0.010353708470805
active Crohn's disease 918 0.0158894802691583
Disease Target Count Z-score Confidence
Malaria 140 3.992 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.010
non-small cell lung cancer 1.246 0.000
lung cancer 1.700 0.000
active Crohn's disease 1.115 0.016
posterior fossa group B ependymoma 1.300 0.000
lung adenocarcinoma 1.120 0.000
ovarian cancer 1.300 0.002
pituitary cancer 1.400 0.000

Synonym

Accession Q9H6T3 B4DRW9 Q6PHR5
Symbols

Gene

PANTHER Protein Class (1)

PDB

4CGV   4CGW  

  Ortholog (10)

Pathway (1)

Gene RIF (6)

PMID Text
23159623 this study investigated the interaction between RPAP3 and PIH1D1.
21184742 These results indicate that RPAP3 may be a novel modulator of NF-kappaB pathway in apoptosis induced by anti-cancer chemotherapeutic agents.
20864038 Data indicate that RNA polymerase II is built in the cytoplasm and reveal quality-control mechanisms that link HSP90 and its cochaperone hSpagh (RPAP3) to the nuclear import of fully assembled enzymes.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
19180575 RPAP3 interacts with Reptin to modulate UV-induced DNA damage by regulating H2AX phosphorylation
18538670 Overexpression of RPAP3 in HEK 293 cells potentiated caspase-3 activation and apoptosis.

AA Sequence

MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAK      1 - 70
ESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKG     71 - 140
NKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAA    141 - 210
RFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQ    211 - 280
QAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYS    281 - 350
KAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI    351 - 420
DNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSD    421 - 490
TPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLK    491 - 560
SSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMF    561 - 630
MSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG                                       631 - 665
//

Text Mined References (32)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159623 2013 RPAP3 splicing variant isoform 1 interacts with PIH1D1 to compose R2TP complex for cell survival.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...