Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.36
PubTator Score 6.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.100 5.5e-04
ductal carcinoma in situ 1.900 2.9e-03
interstitial cystitis -1.600 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
invasive ductal carcinoma 2.400 3.7e-03
spina bifida -1.617 4.4e-02

Gene RIF (8)

AA Sequence

MTPPPPPPPPPGPDPAADPAADPCPWPGSLVVLFGATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTL      1 - 70
HKSLVRAEAAALSTQCREASGLSADSLARAEPLDKVLQQFSQLVNGDVALLGGGPYMLCTDGQQLLRQVL     71 - 140
HPEASRKNLVLPDMFFSFYDLRREFHMQHPSTCPARDLTVATMAQGLGLETDATEDDFGVWEVKTMVAVI    141 - 210
LHLLKEPSSQLFSKPEVIKQKYETGPCSDSTVPCPYSSKADVVDSETVVRARGLPWQSSDQDVARFFKGL    211 - 280
NVARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHMGVRYIEVYKATGEEFVKIAGGTSLEVAR    281 - 350
FLSREDQVILRLRGLPFSAGPTDVLGFLGPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALR    351 - 420
RHKGMLGKRYIELFRSTAAEVQQVLNRYASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATIED    421 - 490
ILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKVMKERYVEVVPCSTEEMSR    491 - 560
VLMGGTLGRSGMSPPPCKLPCLSPPTYTTFQATPTLIPTETAALYPSSALLPAARVPAAPTPVAYYPGPA    561 - 630
TQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLP    631 - 700
ADDYTSLMPVGDPPRTVLQAPKEWVCL                                               701 - 727
//

Text Mined References (20)

PMID Year Title