Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.55
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (3)

AA Sequence

MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLE      1 - 70
EKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRT     71 - 140
EVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQ    141 - 210
KLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTA    211 - 280
TYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV    281 - 350
FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN                                351 - 392
//

Text Mined References (22)

PMID Year Title