Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.52
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.45744376209478E-5

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 0.000

Synonym

Accession Q9H6R6 D3DRB6 Q53G45 Q96IV7 Q9H605
Symbols DHHC-6
ZNF376

Gene

  Ortholog (15)

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
25368151 DHHC6 knockdown using shRNA in stably transfected cell lines led to decreased expression of the IP3R and impaired IP3R-dependent Ca(2+) flux.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19801377 Data show that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 appear to be S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain.

AA Sequence

MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILY      1 - 70
NYFNAMFVGPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQN     71 - 140
HASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAFATTLFAL    141 - 210
GLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSG    211 - 280
VPEGDGLEWPVREGCHQYSLTIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIQ    281 - 350
LQKGEFILATRGLRYWLYGDKILDDSFIEGVSRIRGWFPRKCVEKCPCDAETDQAPEGEKKNR           351 - 413
//

Text Mined References (11)

PMID Year Title
25368151 2014 Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22314232 2012 Palmitoylated calnexin is a key component of the ribosome-translocon complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19801377 2010 Proteome scale characterization of human S-acylated proteins in lipid raft-enriched and non-raft membranes.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...