Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $76,500
PubMed Score 1.52
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 0.000

Synonym

Accession Q9H6R6 D3DRB6 Q53G45 Q96IV7 Q9H605
Symbols DHHC-6
ZNF376

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
25368151 DHHC6 knockdown using shRNA in stably transfected cell lines led to decreased expression of the IP3R and impaired IP3R-dependent Ca(2+) flux.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19801377 Data show that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 appear to be S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain.

AA Sequence

MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILY      1 - 70
NYFNAMFVGPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQN     71 - 140
HASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAFATTLFAL    141 - 210
GLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSG    211 - 280
VPEGDGLEWPVREGCHQYSLTIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIQ    281 - 350
LQKGEFILATRGLRYWLYGDKILDDSFIEGVSRIRGWFPRKCVEKCPCDAETDQAPEGEKKNR           351 - 413
//

Text Mined References (11)

PMID Year Title
25368151 2014 Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22314232 2012 Palmitoylated calnexin is a key component of the ribosome-translocon complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19801377 2010 Proteome scale characterization of human S-acylated proteins in lipid raft-enriched and non-raft membranes.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...