Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.83
PubTator Score 5.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.3e-11
osteosarcoma 7950 9.4e-08
acute quadriplegic myopathy 1158 1.3e-07
Disease Target Count Z-score Confidence
Microphthalmia with limb anomalies 40 3.454 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.172 1.3e-07
juvenile dermatomyositis 1.019 1.3e-11
osteosarcoma -1.973 9.4e-08

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MPEEAGFPPAKRFRPGSGPPSRAGSFPPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSASPYPEAVELQ      1 - 70
RRSLPIFQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVS     71 - 140
DEKRTELGKLVGYTVRFDDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVV    141 - 210
KAAQKRRKELGKLPLKVIVMSATMDVDLFSQYFNGAPVLYLEGRQHPIQVFYTKQPQNDYLHAALVSVFQ    211 - 280
IHQEAPSSQDILVFLTGQEEIEAMSKTCRDIAKHLPDGCPAMLVLPLYASLPYAQQLRVFQGAPKGYRKV    281 - 350
IISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTE    351 - 420
DEFEKFDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTL    421 - 490
TPMGRKMAAFPLEPKFAKTILMSPKFHCTEEILTIVSLLSVDSVLHNPPSRREEVQGVRKKFISSEGDHM    491 - 560
TLLNIYRTFKNLGGNKDWCKENFVNSKNMTLVAEVRAQLRDICLKMSMPIASSRGDVESVRRCLAHSLFM    561 - 630
STAELQPDGTYATTDTHQPVAIHPSSVLFHCKPACVVYTELLYTNKCYMRDLCVIDAQWLYEAAPEYFRR    631 - 700
KLRTARN                                                                   701 - 707
//

Text Mined References (18)

PMID Year Title