Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.12
PubTator Score 5.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.973 0.000
juvenile dermatomyositis 1.019 0.000
acute quadriplegic myopathy 1.172 0.000

Synonym

Accession Q9H6R0 B4DHF9 Q4G149 Q5CZ73 Q9H5M9
Symbols DDX33

Gene

Gene RIF (8)

PMID Text
26100019 The results reveal a newly recognized function of DHX33 in mRNA translation initiation, further solidifying its central role in promoting cell growth and proliferation.
23871209 Data indicate that DHX33 forms the inflammasome complex with NLRP3 following stimulation with cytosolic RNA.
23401854 results directly implicate DHX33 as a crucial player in establishing rRNA synthesis rates in the face of Ras(V12) or ARF signals, adjusting ribosome biogenesis to match the appropriate growth or antigrowth signals.
21930779 we show the mechanistic importance of DHX33 in rRNA transcription and proliferation
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of DEAH (Asp-Glu-Ala-His) box polypeptide 33 (DHX33) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MPEEAGFPPAKRFRPGSGPPSRAGSFPPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSASPYPEAVELQ      1 - 70
RRSLPIFQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVS     71 - 140
DEKRTELGKLVGYTVRFDDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVV    141 - 210
KAAQKRRKELGKLPLKVIVMSATMDVDLFSQYFNGAPVLYLEGRQHPIQVFYTKQPQNDYLHAALVSVFQ    211 - 280
IHQEAPSSQDILVFLTGQEEIEAMSKTCRDIAKHLPDGCPAMLVLPLYASLPYAQQLRVFQGAPKGYRKV    281 - 350
IISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTE    351 - 420
DEFEKFDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTL    421 - 490
TPMGRKMAAFPLEPKFAKTILMSPKFHCTEEILTIVSLLSVDSVLHNPPSRREEVQGVRKKFISSEGDHM    491 - 560
TLLNIYRTFKNLGGNKDWCKENFVNSKNMTLVAEVRAQLRDICLKMSMPIASSRGDVESVRRCLAHSLFM    561 - 630
STAELQPDGTYATTDTHQPVAIHPSSVLFHCKPACVVYTELLYTNKCYMRDLCVIDAQWLYEAAPEYFRR    631 - 700
KLRTARN                                                                   701 - 707
//

Text Mined References (14)

PMID Year Title
26100019 2015 The DHX33 RNA Helicase Promotes mRNA Translation Initiation.
23871209 2013 The DHX33 RNA helicase senses cytosolic RNA and activates the NLRP3 inflammasome.
23401854 2013 P19ARF and RasV¹² offer opposing regulation of DHX33 translation to dictate tumor cell fate.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21930779 2011 Identification of DHX33 as a mediator of rRNA synthesis and cell growth.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...