Property Summary

NCBI Gene PubMed Count 15
PubMed Score 40.06
PubTator Score 21.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.100 9.9e-04
osteosarcoma 1.014 2.6e-04
psoriasis 1.200 1.2e-30
tuberculosis -1.200 5.4e-06

Gene RIF (5)

AA Sequence

MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT      1 - 70
VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA     71 - 140
SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV    141 - 210
QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA                       211 - 261
//

Text Mined References (15)

PMID Year Title