Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H6N6
Symbols MYH5
MHC20
MYH16P

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MGLKVIQQNVHKFLQLRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRKAMAQTQELVNKVKELEEKTA      1 - 70
TLSQEKNDLTIQLQAEQENLMDAEERLTWMMKTKMDLESQISDMRERLEEEEGMAASLSAAKRKLEGELS     71 - 140
DLKRDLEGLETTLAKTEKEKQALDHKVRTLTGDLSLREDSITKLQKEKRALEELHQKTLDDLQAEEDKVN    141 - 210
HLTKNNSKLSTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDLEIN    211 - 280
SVNSKYEDEQSLNSTLQRKLKEHQDRIEELEEELEAERAMRAKIEQNRKREAELLKLRRELEEAALQSEA    281 - 350
TASTLRKKHVDSMAELTEHVESLQRVKSKLEKDKQVMKAEIDDLNASMETIQKSKMNAEAHVRKLEDSLS    351 - 420
EANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRS    421 - 490
TAVVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARL    491 - 560
QEAEEAAETAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQRLFDKMLAEWQQKCEELQVEV    561 - 630
DSSQKECRMYMTESFKIKTAYEESLEHLESVKKENKTLQEEIKDLIDQLGEGGRSVHELQKLKKKLEMEK    631 - 700
EELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKG    701 - 770
RAEALRLKKKMETDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELRKQYNLQERR    771 - 840
LSLLQTELEEVRSALEGSERSRKLLEQEVVEITEWHNEINIQNQSLLVVKRKLESDVQRISNEHEELISE    841 - 910
FRLTEERAKKAMMDAARMAEELRQEQDHCMHLEKIKKNYEVTIKDLQAKMEEAEQLALKGGKRTIMKLEA    911 - 980
RIKELETELDGEQKQHVETVKTLCKNERRLKELVFQTEEDHKTNQRMQALVEKLQNKLKVYKRQIEEAED    981 - 1050
QANQTLARYRKTVHELDDAEDRAGMAETALNKLRTRHRVAGKGITSV                          1051 - 1097
//

Text Mined References (9)

PMID Year Title