Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H6N6
Symbols MYH5
MHC20
MYH16P

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15042088 first proteomic distinction between humans and chimpanzees that can be correlated with a traceable anatomic imprint in the fossil record

AA Sequence

MGLKVIQQNVHKFLQLRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRKAMAQTQELVNKVKELEEKTA      1 - 70
TLSQEKNDLTIQLQAEQENLMDAEERLTWMMKTKMDLESQISDMRERLEEEEGMAASLSAAKRKLEGELS     71 - 140
DLKRDLEGLETTLAKTEKEKQALDHKVRTLTGDLSLREDSITKLQKEKRALEELHQKTLDDLQAEEDKVN    141 - 210
HLTKNNSKLSTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDLEIN    211 - 280
SVNSKYEDEQSLNSTLQRKLKEHQDRIEELEEELEAERAMRAKIEQNRKREAELLKLRRELEEAALQSEA    281 - 350
TASTLRKKHVDSMAELTEHVESLQRVKSKLEKDKQVMKAEIDDLNASMETIQKSKMNAEAHVRKLEDSLS    351 - 420
EANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRS    421 - 490
TAVVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARL    491 - 560
QEAEEAAETAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQRLFDKMLAEWQQKCEELQVEV    561 - 630
DSSQKECRMYMTESFKIKTAYEESLEHLESVKKENKTLQEEIKDLIDQLGEGGRSVHELQKLKKKLEMEK    631 - 700
EELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKG    701 - 770
RAEALRLKKKMETDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELRKQYNLQERR    771 - 840
LSLLQTELEEVRSALEGSERSRKLLEQEVVEITEWHNEINIQNQSLLVVKRKLESDVQRISNEHEELISE    841 - 910
FRLTEERAKKAMMDAARMAEELRQEQDHCMHLEKIKKNYEVTIKDLQAKMEEAEQLALKGGKRTIMKLEA    911 - 980
RIKELETELDGEQKQHVETVKTLCKNERRLKELVFQTEEDHKTNQRMQALVEKLQNKLKVYKRQIEEAED    981 - 1050
QANQTLARYRKTVHELDDAEDRAGMAETALNKLRTRHRVAGKGITSV                          1051 - 1097
//

Text Mined References (9)

PMID Year Title
24240322 2014 HiRIEF LC-MS enables deep proteome coverage and unbiased proteogenomics.
18085818 2007 Comparative genomics search for losses of long-established genes on the human lineage.
16376411 2006 Of muscle-bound crania and human brain evolution: the story behind the MYH16 headlines.
15470226 2005 Comparative analyses reveal a complex history of molecular evolution for human MYH16.
15042088 2004 Myosin gene mutation correlates with anatomical changes in the human lineage.
15014174 2004 Evolution of sarcomeric myosin heavy chain genes: evidence from fish.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11919279 2002 Evolutionary implications of three novel members of the human sarcomeric myosin heavy chain gene family.