Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-04
non primary Sjogren syndrome sicca 891 1.9e-02

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.9e-02
osteosarcoma -1.175 1.2e-04

Synonym

Accession Q9H6L4 B4DVA4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEEN      1 - 70
ETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATP     71 - 140
VVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR                141 - 198
//

Text Mined References (9)

PMID Year Title