Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.58
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.353 7.8e-03
atypical teratoid / rhabdoid tumor 1.200 4.0e-03
Breast cancer -1.100 1.8e-05
ependymoma 2.500 1.9e-02
nasopharyngeal carcinoma -1.700 6.9e-06
osteosarcoma 1.144 7.3e-03
ovarian cancer 1.300 1.5e-03

 CSPA Cell Line (2)

Gene RIF (4)

AA Sequence

MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV      1 - 70
ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT     71 - 140
FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL    141 - 210
THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF    211 - 280
LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS                                      281 - 316
//

Text Mined References (15)

PMID Year Title