Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma multiforme -1.100 0.000
osteosarcoma 1.393 0.000
posterior fossa group B ependymoma -1.500 0.000
invasive ductal carcinoma 1.300 0.009
ovarian cancer 1.500 0.000

Synonym

Accession Q9H6K5 A0A087WZ52 Q9H3X1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MDNKRDKAKAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGGIGGATI      1 - 70
PESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLGQKGLRISAEE     71 - 140
TVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTEVGLPRPAPSARPRPPTEGPRKSVS    141 - 210
SASEHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQAL    211 - 280
RPPQVTPPRKDAAPALGPLSSSPLATPSPSGTKARPVPPPDNAATPLPATLPPSPPVTPPPPAALQSQAP    281 - 350
PTLPATPHSSSLTCQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQVPPTQLIMSFPEAGVSSLATAAFV    351 - 420
ASVSPSVSSPLQSMPPTQANPALPSLPTLLSPLATPPLSAMSPLQGPVSPATSLGNSAFPLAALPQPGLS    421 - 490
ALTTPPPQASPSPSPPSLQATPHTLATLPLQDSPLLATLPLQASPSPLTTVSLQDPPLVSPSLLASPPLQ    491 - 560
APPHPQAPPSMTTPPMQAPPSLQTIPPIQVPHSLTSPSLQAPPSPLALSSLQATTSLGSPTLQATHSFLT    561 - 630
MSPRQTQASLISPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPAVSPLSSPLTIHPLQALSSLASHSPQ    631 - 700
APLSSLIMPPLETQSSLAPPSLQTPPASLTTPPLENLPSLAPPPLQTASAPLTTPPLENLPSLAPPPLQT    701 - 770
ASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPALASPPLQGLPSPPLSPLATPP    771 - 840
PQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPS    841 - 910
ATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQVPPSPPASPPMSPSATPPPRVP    911 - 980
PLLAAPPLQVPPSPPASLPMSPLAKPPPQAPPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPP    981 - 1050
PQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLA   1051 - 1120
GHSSSATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGS   1121 - 1190
ADGLCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRSPKQARLGELPLGALQASVVQHL   1191 - 1260
LSRTLLLAAAEGAAGGSGGGPGGAEGGGVTGGARAALSDAELGRWAELLSPLDESRASITSVTSFSPDDV   1261 - 1330
ASPQGDWTVVEVETFH                                                         1331 - 1346
//

Text Mined References (6)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.