Property Summary

NCBI Gene PubMed Count 28
PubMed Score 45.92
PubTator Score 35.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma -1.100 9.3e-06
osteosarcoma -1.038 2.4e-05

Gene RIF (16)

AA Sequence

MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP      1 - 70
LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV     71 - 140
QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK                                   141 - 179
//

Text Mined References (30)

PMID Year Title