Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.01
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25953261 High C6orf106 expression was significantly correlated with lymph node metastasis in triple-negative breast cancer.
25736925 C6orf106 promotes invasion in NSCLC cells. Finally, C6orf106 upregulates vimentin, and downregulates E-cadherin and P120ctn.
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
19059477 up-regulated expression by repetitive low-grade oxidative stress through p38MAPK or NF-kappaB pathways
18793612 DSCR2 was found to interact with PPARbeta and to inhibit it.
18003597 Ethanol, but not acetaldehyde, inhibited PPAR-beta transactivation.

AA Sequence

MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNI      1 - 70
SVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIA     71 - 140
DVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNF    141 - 210
NPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNL    211 - 280
SVVTYSKGLHGPYPFGQS                                                        281 - 298
//

Text Mined References (31)

PMID Year Title
25953261 2015 A novel biomarker C6orf106 promotes the malignant progression of breast cancer.
25736925 2015 C6orf106 enhances NSCLC cell invasion by upregulating vimentin, and downregulating E-cadherin and P120ctn.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23940030 2013 The F-box protein FBXO25 promotes the proteasome-dependent degradation of ELK-1 protein.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21832049 2011 Interactions of pathological hallmark proteins: tubulin polymerization promoting protein/p25, beta-amyloid, and alpha-synuclein.
More...