Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Acne vulgaris 16
Disease Target Count P-value
lung carcinoma 2844 2.41363055828252E-16
medulloblastoma 1524 6.50251177908933E-6
ovarian cancer 8492 7.24476830478932E-6
osteosarcoma 7933 8.24607406524339E-5
medulloblastoma, large-cell 6234 4.41063510830617E-4
cutaneous lupus erythematosus 1056 0.00337694804872496
non primary Sjogren syndrome sicca 840 0.0185416839956104

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 0.003
osteosarcoma 1.136 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.500 0.000
non primary Sjogren syndrome sicca 1.100 0.019
lung carcinoma 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQA      1 - 70
TPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFL     71 - 140
FAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLC    141 - 210
DRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPG    211 - 280
LVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET                       281 - 331
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24399259 2014 Two new susceptibility loci 1q24.2 and 11p11.2 confer risk to severe acne.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...