Property Summary

NCBI Gene PubMed Count 63
PubMed Score 215.14
PubTator Score 112.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.139 1.8e-02
breast carcinoma -1.900 7.2e-06
ductal carcinoma in situ -1.100 6.9e-03
fibroadenoma -2.300 2.3e-03
inflammatory breast cancer -1.200 7.5e-03
interstitial cystitis 1.100 7.1e-04
intraductal papillary-mucinous adenoma (... -1.100 2.6e-04
intraductal papillary-mucinous carcinoma... -1.200 3.8e-04
intraductal papillary-mucinous neoplasm ... -1.100 4.4e-03
invasive ductal carcinoma -1.200 6.5e-03
lung adenocarcinoma -2.200 6.5e-12
lung cancer -1.800 1.3e-04
non-small cell lung cancer -2.656 1.9e-25
osteosarcoma -2.190 1.7e-03
ovarian cancer 3.600 1.6e-09
psoriasis -1.300 3.6e-06

Gene RIF (52)

AA Sequence

MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGESRIRR      1 - 70
PMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPR     71 - 140
RRKQVKRLKRVEGGFLHGLAEPQAAALGPEGGRVAMDGLGLQFPEQGFPAGPPLLPPHMGGHYRDCQSLG    141 - 210
APPLDGYPLPTPDTSPLDGVDPDPAFFAAPMPGDCPAAGTYSYAQVSDYAGPPEPPAGPMHPRLGPEPAG    211 - 280
PSIPGLLAPPSALHVYYGAMGSPGAGGGRGFQMQPQHQHQHQHQHHPPGPGQPSPPPEALPCRDGTDPSQ    281 - 350
PAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV          351 - 414
//

Text Mined References (64)

PMID Year Title