Property Summary

NCBI Gene PubMed Count 58
Grant Count 64
R01 Count 49
Funding $7,958,694.74
PubMed Score 199.81
PubTator Score 112.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H6I2
Symbols VUR3

Gene

PDB

2YUL   4A3N  

Gene RIF (47)

PMID Text
26463399 high expression of the Sox17 associated pathway in medium and small arteries indicates that Brain arteriovenous malformation vessels are intrinsically active
26411902 Knockdown of OCT4 during differentiation inhibits mesendoderm formation and removal of the H3K27me3 mark from the SOX17 promoter, suggesting that OCT4 acts to induce removal of the Polycomb2 complex.
25971583 Decreased expression of SOX17 is associated with tumor progression in breast cancer.
25953442 SOX17 might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25868860 SOX17 demethylation induced miR-371-5p expression and consequently suppressed its direct target SOX2. A novel mechanism of the SOX17/miR-371-5p/SOX2 axis is involved in the regulation of EMT, stemness and metastasis.
25789956 promoter methylation may play an important role in breast cancer progression and could be used as a prognostic biomarker to identify patients at risk of developing metastasis or recurrence after mastectomy
25674225 In this study, oligodendroglioma patients with 1p/19q LOH and Sox17 protein expression had a better prognosis.
25596186 Human intracranial aneurysm samples showed reduced Sox17 expression and impaired endothelial integrity.
25543152 SOX17 is the key regulator of human primordial germ cells-like cells specification, whereas BLIMP1 represses endodermal and other somatic genes during hPGCLC specification.
25310020 Decreased Sox17 expression is correlated with melanoma progression, an unfavorable survival of melanoma patients and is an independent molecular prognostic factor for melanoma.
More...

AA Sequence

MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGESRIRR      1 - 70
PMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPR     71 - 140
RRKQVKRLKRVEGGFLHGLAEPQAAALGPEGGRVAMDGLGLQFPEQGFPAGPPLLPPHMGGHYRDCQSLG    141 - 210
APPLDGYPLPTPDTSPLDGVDPDPAFFAAPMPGDCPAAGTYSYAQVSDYAGPPEPPAGPMHPRLGPEPAG    211 - 280
PSIPGLLAPPSALHVYYGAMGSPGAGGGRGFQMQPQHQHQHQHQHHPPGPGQPSPPPEALPCRDGTDPSQ    281 - 350
PAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV          351 - 414
//

Text Mined References (58)

PMID Year Title
26463399 2016 Immunohistochemical Analysis of Sox17 Associated Pathway in Brain Arteriovenous Malformations.
26411902 2015 OCT4 Coordinates with WNT Signaling to Pre-pattern Chromatin at the SOX17 Locus during Human ES Cell Differentiation into Definitive Endoderm.
25971583 2015 Decreased expression of SOX17 is associated with tumor progression and poor prognosis in breast cancer.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25868860 2015 The SOX17/miR-371-5p/SOX2 axis inhibits EMT, stem cell properties and metastasis in colorectal cancer.
25789956 2015 Sox17 promoter methylation in plasma DNA is associated with poor survival and can be used as a prognostic factor in breast cancer.
25674225 2014 Clinical significance of chromosome 1p/19q loss of heterozygosity and Sox17 expression in oligodendrogliomas.
25596186 2015 Deficiency of endothelium-specific transcription factor Sox17 induces intracranial aneurysm.
25543152 2015 SOX17 is a critical specifier of human primordial germ cell fate.
25310020 2014 Reduced expression of SRY-box containing gene 17 correlates with an unfavorable melanoma patient survival.
More...