Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.30
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.4e-05
inflammatory breast cancer 286 8.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer 1.200 8.6e-03
osteosarcoma -1.099 4.4e-05

 GO Function (1)

Gene RIF (1)

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFISWFPFYYEIKM      1 - 70
AFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLSFGKRGLNIAASAAVQAATKS     71 - 140
QGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHRRPPIGYRAGGLQDSDTEDECWSDTEAVPRA    141 - 210
PARPREKPLIRSQSLRVVKRKPPVREGTSRSLKVRTRKKTVPSDVDS                           211 - 257
//

Text Mined References (16)

PMID Year Title