Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $355,983
PubMed Score 1.30
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.099 0.000
inflammatory breast cancer 1.200 0.009

Synonym

Accession Q9H6H4 D3DSQ9 Q86VL1 Q9H6I5 Q9HBP4
Symbols PP432
Yip2c
C8orf20

Gene

PANTHER Protein Class (1)

 Grant Application (1)

 GO Function (1)

Gene RIF (1)

PMID Text
23911198 Our results show that REEP3/4 function redundantly to clear the endoplasmic reticulum from metaphase chromatin, thereby ensuring correct progression through mitosis and proper nuclear envelope architecture.

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFISWFPFYYEIKM      1 - 70
AFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLSFGKRGLNIAASAAVQAATKS     71 - 140
QGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHRRPPIGYRAGGLQDSDTEDECWSDTEAVPRA    141 - 210
PARPREKPLIRSQSLRVVKRKPPVREGTSRSLKVRTRKKTVPSDVDS                           211 - 257
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911198 2013 REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16421571 2006 DNA sequence and analysis of human chromosome 8.
More...