Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.45
PubTator Score 2.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (6)

AA Sequence

MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSP      1 - 70
RLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQ     71 - 140
NKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFG    141 - 210
AKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLA    211 - 280
KDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQK    281 - 350
QPPQQPAAKI                                                                351 - 360
//

Text Mined References (30)

PMID Year Title