Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.81
PubTator Score 3.97

Knowledge Summary

Patent (494)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-03
astrocytic glioma -1.300 4.2e-03
Astrocytoma, Pilocytic -1.800 7.0e-08
atypical teratoid / rhabdoid tumor -1.900 7.6e-08
ependymoma -1.500 2.6e-07
glioblastoma -1.500 5.6e-05
group 3 medulloblastoma -1.900 1.8e-04
intraductal papillary-mucinous adenoma (... 1.800 1.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.8e-02
medulloblastoma, large-cell -2.200 1.2e-04
oligodendroglioma -1.100 7.5e-03
osteosarcoma -1.158 2.3e-02
primitive neuroectodermal tumor -2.500 1.6e-06

Gene RIF (2)

AA Sequence

MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPIASWLCAMLHCFGSYILAD      1 - 70
LLLGEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHH     71 - 140
YHHGWFVMIATGWVKGSGVALMSNFEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKA    141 - 210
SLIFIFTLFMVSCKVFLTATHSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPA    211 - 280
KSKEELSEGSRKKKAKKAD                                                       281 - 299
//

Text Mined References (8)

PMID Year Title