Property Summary

NCBI Gene PubMed Count 19
PubMed Score 44.55
PubTator Score 23.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.50848394082801E-6
non primary Sjogren syndrome sicca 840 0.0177036150523076
Disease Target Count Z-score Confidence
Perlman syndrome 9 5.467 2.7
Sleeping sickness 37 4.303 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.115 0.000
non primary Sjogren syndrome sicca 1.300 0.018

Synonym

Accession Q9H6E5 A1A527 A8K995 Q2NL65 Q7L583 Q9H6H7 Star-PAP
Symbols PAPD2
RBM21
URLC6
TUTase
STARPAP

Gene

PANTHER Protein Class (2)

PDB

2E5G  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (10)

PMID Text
26496945 Star-PAP recognises a unique nucleotide motif on its target mRNA.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25142229 Nucleotidyl transferase TUT1 inhibits lipogenesis in osteosarcoma cells through regulation of microRNA-24 and microRNA-29a.
23874977 The human TUT1 nucleotidyl transferase is a global regulator of microRNA abundance.
23416977 Star-PAP controls E6 mRNA polyadenylation and expression and modulates wild-type p53 levels.
23306079 Star-PAP and its regulatory molecules form a signaling nexus at the 3'-end of target mRNAs to control the expression of select group of genes including the ones involved in stress responses. (Review)
23166591 Expression of HIV-1 Tat upregulates the abundance of terminal uridylyl transferase 1 (TUT1) in the nucleoli of Jurkat T-cells
22244330 PIPKIalpha, PI4,5P(2), and PKCdelta regulate Star-PAP control of BIK expression and induction of apoptosis.
21102410 The data support a model where Star-PAP binds to the pre-mRNA, recruits the CPSF complex to the 3'-end of pre-mRNA and then defines cleavage by CPSF 73 and subsequent polyadenylation of its target mRNAs.
18305108 These data indicate that CKIalpha, PIPKIalpha, and Star-PAP function together to modulate the production of specific Star-PAP messages.
18288197 PIPKIalpha co-localizes at nuclear speckles and interacts with a newly identified non-canonical poly(A) polymerase, Star-PAP; the activity of Star-PAP can be specifically regulated by PtdIns4,5P2

AA Sequence

MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFVSGFPRDVDSA      1 - 70
QLSEYFLAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHSLGGHRLRVRPREQKEFQSPASKSPK     71 - 140
GAAPDSHQLAKALAEAADVGAQMIKLVGLRELSEAERQLRSLVVALMQEVFTEFFPGCVVHPFGSSINSF    141 - 210
DVHGCDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFET    211 - 280
PSSSLAPQTPDSALASETLASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRG    281 - 350
CVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGR    351 - 420
GLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEP    421 - 490
LSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGGLPSNLWEGLRLGPLNLQDPFDLSHNVAANVTSRVA    491 - 560
GRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSSLLSATPIPLPLAPFTQLTAALVQVFREA    561 - 630
LGCHIEQATKRTRSEGGGTGESSQGGTSKRLKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMV    631 - 700
QDWAMQSPGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAGKGASLPSSASWRCAL    701 - 770
WHRVWQGRRRARRRLQQQTKEGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD    771 - 840
RMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK                                        841 - 874
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25142229 2014 Nucleotidyl transferase TUT1 inhibits lipogenesis in osteosarcoma cells through regulation of microRNA-24 and microRNA-29a.
23874977 2013 The human TUT1 nucleotidyl transferase as a global regulator of microRNA abundance.
23416977 2014 Star-PAP controls HPV E6 regulation of p53 and sensitizes cells to VP-16.
23306079 2013 The novel poly(A) polymerase Star-PAP is a signal-regulated switch at the 3'-end of mRNAs.
22244330 2012 Star-PAP control of BIK expression and apoptosis is regulated by nuclear PIPKI? and PKC? signaling.
21102410 2010 The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA.
18305108 2008 CKIalpha is associated with and phosphorylates star-PAP and is also required for expression of select star-PAP target messenger RNAs.
18288197 2008 A PtdIns4,5P2-regulated nuclear poly(A) polymerase controls expression of select mRNAs.
More...