Property Summary

NCBI Gene PubMed Count 22
PubMed Score 47.88
PubTator Score 23.73

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
non primary Sjogren syndrome sicca 891 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Perlman syndrome 9 5.309 2.7
Sleeping sickness 37 4.114 2.1


  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 1.8e-02
osteosarcoma -1.115 1.5e-06

Gene RIF (13)

AA Sequence

RMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK                                        841 - 874

Text Mined References (23)

PMID Year Title