Property Summary

NCBI Gene PubMed Count 19
Grant Count 38
R01 Count 31
Funding $4,792,000.17
PubMed Score 44.55
PubTator Score 23.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.115 0.000
non primary Sjogren syndrome sicca 1.300 0.018

Gene RIF (10)

PMID Text
26496945 Star-PAP recognises a unique nucleotide motif on its target mRNA.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25142229 Nucleotidyl transferase TUT1 inhibits lipogenesis in osteosarcoma cells through regulation of microRNA-24 and microRNA-29a.
23874977 The human TUT1 nucleotidyl transferase is a global regulator of microRNA abundance.
23416977 Star-PAP controls E6 mRNA polyadenylation and expression and modulates wild-type p53 levels.
23306079 Star-PAP and its regulatory molecules form a signaling nexus at the 3'-end of target mRNAs to control the expression of select group of genes including the ones involved in stress responses. (Review)
23166591 Expression of HIV-1 Tat upregulates the abundance of terminal uridylyl transferase 1 (TUT1) in the nucleoli of Jurkat T-cells
22244330 PIPKIalpha, PI4,5P(2), and PKCdelta regulate Star-PAP control of BIK expression and induction of apoptosis.
21102410 The data support a model where Star-PAP binds to the pre-mRNA, recruits the CPSF complex to the 3'-end of pre-mRNA and then defines cleavage by CPSF 73 and subsequent polyadenylation of its target mRNAs.
18305108 These data indicate that CKIalpha, PIPKIalpha, and Star-PAP function together to modulate the production of specific Star-PAP messages.
18288197 PIPKIalpha co-localizes at nuclear speckles and interacts with a newly identified non-canonical poly(A) polymerase, Star-PAP; the activity of Star-PAP can be specifically regulated by PtdIns4,5P2

AA Sequence

MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFVSGFPRDVDSA      1 - 70
QLSEYFLAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHSLGGHRLRVRPREQKEFQSPASKSPK     71 - 140
GAAPDSHQLAKALAEAADVGAQMIKLVGLRELSEAERQLRSLVVALMQEVFTEFFPGCVVHPFGSSINSF    141 - 210
DVHGCDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFET    211 - 280
PSSSLAPQTPDSALASETLASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRG    281 - 350
CVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGR    351 - 420
GLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEP    421 - 490
LSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGGLPSNLWEGLRLGPLNLQDPFDLSHNVAANVTSRVA    491 - 560
GRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSSLLSATPIPLPLAPFTQLTAALVQVFREA    561 - 630
LGCHIEQATKRTRSEGGGTGESSQGGTSKRLKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMV    631 - 700
QDWAMQSPGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAGKGASLPSSASWRCAL    701 - 770
WHRVWQGRRRARRRLQQQTKEGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD    771 - 840
RMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK                                        841 - 874
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25142229 2014 Nucleotidyl transferase TUT1 inhibits lipogenesis in osteosarcoma cells through regulation of microRNA-24 and microRNA-29a.
23874977 2013 The human TUT1 nucleotidyl transferase as a global regulator of microRNA abundance.
23416977 2014 Star-PAP controls HPV E6 regulation of p53 and sensitizes cells to VP-16.
23306079 2013 The novel poly(A) polymerase Star-PAP is a signal-regulated switch at the 3'-end of mRNAs.
22244330 2012 Star-PAP control of BIK expression and apoptosis is regulated by nuclear PIPKI? and PKC? signaling.
21102410 2010 The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA.
18305108 2008 CKIalpha is associated with and phosphorylates star-PAP and is also required for expression of select star-PAP target messenger RNAs.
18288197 2008 A PtdIns4,5P2-regulated nuclear poly(A) polymerase controls expression of select mRNAs.
More...