Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.16
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (5)

PMID Text
25125657 CCDC134 promotes cell proliferation through the JAK3-STAT5 pathway.
23070808 The attenuated expression of CCDC134 promoted the activation of Erk1/2 and JNK/SAPK, but had no effect on p38 in gastric cancer.
22644376 CCDC134 might act as a novel regulator of hADA2a, and plays roles in the PCAF complex via hADA2a to affect its acetyltransferase activity and UV-induced DNA damage repair.
18187620 Knockdown of coiled-coil domain containing 134 (CCDC134) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18087676 These results clearly indicate that CCDC134 is a novel member of the secretory family and down-regulates the Raf-1/MEK/ERK and JNK/ SAPK pathways.

AA Sequence

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML      1 - 70
KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI     71 - 140
RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE    141 - 210
EKRKEIRKGPRISRSQSEL                                                       211 - 229
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25125657 2014 Cytokine-like molecule CCDC134 contributes to CD8? T-cell effector functions in cancer immunotherapy.
23070808 2013 CCDC134 is down-regulated in gastric cancer and its silencing promotes cell migration and invasion of GES-1 and AGS cells via the MAPK pathway.
22644376 2012 CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest.
21269460 2011 Initial characterization of the human central proteome.
21123754 2011 Genome-wide association study of CSF biomarkers Abeta1-42, t-tau, and p-tau181p in the ADNI cohort.
19946888 2010 Defining the membrane proteome of NK cells.
18087676 2008 CCDC134, a novel secretory protein, inhibits activation of ERK and JNK, but not p38 MAPK.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...