Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.48
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 6.62672035367784E-9
adrenocortical carcinoma 1427 1.15556571994045E-8
medulloblastoma, large-cell 6234 8.54746263181115E-6
osteosarcoma 7933 5.41625702370581E-5
group 3 medulloblastoma 2254 1.98023222949649E-4
psoriasis 6685 3.4926155101962E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00577676205196987

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
psoriasis 1.700 0.000
osteosarcoma 1.729 0.000
medulloblastoma, large-cell -1.400 0.000
adrenocortical carcinoma -1.822 0.000
pancreatic ductal adenocarcinoma liver m... -1.631 0.006
group 3 medulloblastoma -1.100 0.000

Synonym

Accession Q9H6D8 D6W560
Symbols FRCP1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
27066907 FNDC4 as a factor with direct therapeutic potential in inflammatory bowel disease and possibly other inflammatory diseases.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12384288 Reports the cloning, expression and subcellular localization of the related mouse protein.

AA Sequence

MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP      1 - 70
EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG     71 - 140
SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP    141 - 210
EQSPQGRPVGTRQKKSPSINTIDV                                                  211 - 234
//

Text Mined References (15)

PMID Year Title
27066907 2016 FNDC4 acts as an anti-inflammatory factor on macrophages and improves colitis in mice.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...