Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.42
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H6D3 hXkr8
Symbols XRG8
hXkr8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (4)

AA Sequence

MPWSSRGALLRDLVLGVLGTAAFLLDLGTDLWAAVQYALGGRYLWAALVLALLGLASVALQLFSWLWLRA      1 - 70
DPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFL     71 - 140
ETAPQLTLVLAIMLQSGRAEYYQWVGICTSFLGISWALLDYHRALRTCLPSKPLLGLGSSVIYFLWNLLL    141 - 210
LWPRVLAVALFSALFPSYVALHFLGLWLVLLLWVWLQGTDFMPDPSSEWLYRVTVATILYFSWFNVAEGR    211 - 280
TRGRAIIHFAFLLSDSILLVATWVTHSSWLPSGIPLQLWLPVGCGCFFLGLALRLVYYHWLHPSCCWKPD    281 - 350
PDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG                             351 - 395
//

Text Mined References (9)

PMID Year Title