Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.92
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26936867 facilitates transbilayer migration of lipids [review]
23845944 findings show the Xk-family protein Xkr8 mediates phosphatidylserine exposure in response to apoptotic stimuli; Xk-family proteins have evolutionarily conserved roles in promoting phagocytosis of dying cells by altering the phospholipid distribution in the plasma membrane

AA Sequence

MPWSSRGALLRDLVLGVLGTAAFLLDLGTDLWAAVQYALGGRYLWAALVLALLGLASVALQLFSWLWLRA      1 - 70
DPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFL     71 - 140
ETAPQLTLVLAIMLQSGRAEYYQWVGICTSFLGISWALLDYHRALRTCLPSKPLLGLGSSVIYFLWNLLL    141 - 210
LWPRVLAVALFSALFPSYVALHFLGLWLVLLLWVWLQGTDFMPDPSSEWLYRVTVATILYFSWFNVAEGR    211 - 280
TRGRAIIHFAFLLSDSILLVATWVTHSSWLPSGIPLQLWLPVGCGCFFLGLALRLVYYHWLHPSCCWKPD    281 - 350
PDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG                             351 - 395
//

Text Mined References (7)

PMID Year Title
26936867 2016 Getting to the Outer Leaflet: Physiology of Phosphatidylserine Exposure at the Plasma Membrane.
23845944 2013 Xk-related protein 8 and CED-8 promote phosphatidylserine exposure in apoptotic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.