Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
R01 Count 4
Funding $315,585.95
PubMed Score 9.73
PubTator Score 10.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -2.700 0.020
psoriasis 1.700 0.001
non-small cell lung cancer 1.632 0.000
nasopharyngeal carcinoma -1.100 0.022
lung adenocarcinoma 1.254 0.000

Gene RIF (4)

PMID Text
24718283 These results validate the association between promoter hypermethylation of ABHD9 and HOXD3 and prostate cancer recurrence
22798687 The identification of two human epoxide hydrolases: EH3 and EH4.
20723587 Observational study of gene-disease association. (HuGE Navigator)
17437806 methylation of the ABHD9 is significantly associated with prostate cancer prognosis.

AA Sequence

MPELVVTALLAPSRLSLKLLRAFMWSLVFSVALVAAAVYGCIALTHVLCRPRRGCCGRRRSASPACLSDP      1 - 70
SLGEHGFLNLKSSGLRLHYVSAGRGNGPLMLFLHGFPENWFSWRYQLREFQSRFHVVAVDLRGYGPSDAP     71 - 140
RDVDCYTIDLLLVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMSVYQDYSLH    141 - 210
HISQFFRSHYMFLFQLPWLPEKLLSMSDFQILKTTLTHRKTGIPCLTPSELEAFLYNFSQPGGLTGPLNY    211 - 280
YRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQY    281 - 350
MWAFLQDLLD                                                                351 - 360
//

Text Mined References (9)

PMID Year Title
24718283 2014 Validation study of genes with hypermethylated promoter regions associated with prostate cancer recurrence.
22798687 2012 EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
17437806 2007 Discovery and validation of 3 novel DNA methylation markers of prostate cancer prognosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.