Property Summary

NCBI Gene PubMed Count 20
PubMed Score 238.48
PubTator Score 71.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -2.185 1.0e-02
aldosterone-producing adenoma -1.710 6.5e-03
Astrocytoma, Pilocytic -1.800 8.0e-04
Atopic dermatitis -2.300 7.0e-04
autosomal dominant Emery-Dreifuss muscul... 1.291 5.9e-04
Breast cancer -1.600 1.2e-06
breast carcinoma -1.400 3.8e-04
cystic fibrosis 3.994 9.0e-08
ductal carcinoma in situ -2.500 6.9e-04
ependymoma -2.000 2.2e-06
fibroadenoma -1.100 2.1e-02
group 4 medulloblastoma -2.300 6.6e-05
intraductal papillary-mucinous adenoma (... -2.000 5.3e-03
intraductal papillary-mucinous carcinoma... -2.500 6.6e-04
intraductal papillary-mucinous neoplasm ... -2.300 1.3e-02
invasive ductal carcinoma -3.500 1.3e-04
lung carcinoma -1.500 1.5e-18
osteosarcoma 2.658 8.2e-04
ovarian cancer -3.300 1.5e-13
primary pancreatic ductal adenocarcinoma 1.258 3.7e-02
psoriasis -1.300 2.2e-19
ulcerative colitis 2.000 5.9e-04

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH      1 - 70
VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE     71 - 140
GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA    141 - 210
GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP    211 - 280
KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH    281 - 350
ANLTKAETTPSMIPSQSRAFQTV                                                   351 - 373
//

Text Mined References (22)

PMID Year Title