Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.28
PubTator Score 1.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H6B1
Symbols ZNF659

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24024963 ZNF385D is a candidate gene for reading disability and language impairment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQKAVINHTFGV      1 - 70
PLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKSVTAKDSAKTTFTSITTNTIN     71 - 140
TSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKSPTTATGNSSCPSTETEEEKAKRLLYCSLCK    141 - 210
VAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSET    211 - 280
QLKQHISSRRHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVA    281 - 350
VSSPFSLRTAPAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY                             351 - 395
//

Text Mined References (16)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
24024963 2013 Genome-wide association study of shared components of reading disability and language impairment.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
20522523 2010 Common genetic variation and susceptibility to partial epilepsies: a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20205591 2010 Host determinants of HIV-1 control in African Americans.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
More...