Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.92
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 4.84996290923291E-8
osteosarcoma 7933 2.87920380490289E-6
adult high grade glioma 2148 6.64282734714415E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.79685116796335E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.17406657451624E-4
ovarian cancer 8492 4.90459812986673E-4
glioblastoma 5572 9.44365064014299E-4
Atopic dermatitis 944 9.87374980491328E-4
lung cancer 4473 0.00386174114391898
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00462855467827429
cutaneous lupus erythematosus 1056 0.0135507696357853

Expression

Synonym

Accession Q9H6A0 Q5T5V6 Q9BSU0
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (5)

PMID Text
24695972 Higher frequency of promoter hypermethylation of DENND2D is associated with gastric cancer.
24317529 DENND2D is a candidate tumor suppressor gene that was inactivated by promoter hypermethylation in patients with esophageal squamous cell carcinoma and may serve as a novel biomarker of esophageal squamous cell carcinoma.
24189587 DENND2D is a candidate tumor suppressor gene that is inactivated by promoter hypermethylation in patients with Hepatocellular carcinoma and may serve as a novel biomarker of early recurrence of Hepatocellular carcinoma .
23182661 Our data show that DENND2D might function as a tumor suppressor-like gene, preventing survival and expansion of cells with genetic damage through apoptosis mechanism. Absence of DENND2D might play a permissive role, as an early event, in tumorigenesis.
18677770 Mutations in DENND2D in melanoma by inhibition of nonsense-mediated mRNA decay.

AA Sequence

MEGQVVGRVFRLFQRRLLQLRAGPPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDD      1 - 70
YEPIITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWASLTEYPRETFSFVLTNVDGSRKIGYCRR     71 - 140
LLPAGPGPRLPKVYCIISCIGCFGLFSKILDEVEKRHQISMAVIYPFMQGLREAAFPAPGKTVTLKSFIP    141 - 210
DSGTEFISLTRPLDSHLEHVDFSSLLHCLSFEQILQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYP    211 - 280
FSWAHTYIPVVPESLLATVCCPTPFMVGVQMRFQQEVMDSPMEEVLLVNLCEGTFLMSVGDEKDILPPKL    281 - 350
QDDILDSLGQGINELKTAEQINEHVSGPFVQFFVKIVGHYASYIKREANGQGHFQERSFCKALTSKTNRR    351 - 420
FVKKFVKTQLFSLFIQEAEKSKNPPAGYFQQKILEYEEQKKQKKPREKTVK                       421 - 471
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24695972 2015 Prognostic impact of expression and methylation status of DENN/MADD domain-containing protein 2D in gastric cancer.
24317529 2014 Reduced expression of DENND2D through promoter hypermethylation is an adverse prognostic factor in squamous cell carcinoma of the esophagus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189587 2014 Downregulation of DENND2D by promoter hypermethylation is associated with early recurrence of hepatocellular carcinoma.
23182661 2013 Suppression of non-small cell lung cancer proliferation and tumorigenicity by DENND2D.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
18677770 2008 Identification of ARHGEF17, DENND2D, FGFR3, and RB1 mutations in melanoma by inhibition of nonsense-mediated mRNA decay.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...