Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.92
PubTator Score 9.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.600 6.6e-05
Astrocytoma, Pilocytic 1.400 1.6e-08
Atopic dermatitis 1.100 9.9e-04
cutaneous lupus erythematosus 1.100 1.4e-02
glioblastoma 1.100 3.7e-05
intraductal papillary-mucinous adenoma (... 1.400 2.8e-04
intraductal papillary-mucinous carcinoma... 1.900 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.700 4.6e-03
lung cancer -1.800 3.9e-03
osteosarcoma -3.293 2.9e-06
ovarian cancer 1.500 4.9e-04

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MEGQVVGRVFRLFQRRLLQLRAGPPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDD      1 - 70
YEPIITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWASLTEYPRETFSFVLTNVDGSRKIGYCRR     71 - 140
LLPAGPGPRLPKVYCIISCIGCFGLFSKILDEVEKRHQISMAVIYPFMQGLREAAFPAPGKTVTLKSFIP    141 - 210
DSGTEFISLTRPLDSHLEHVDFSSLLHCLSFEQILQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYP    211 - 280
FSWAHTYIPVVPESLLATVCCPTPFMVGVQMRFQQEVMDSPMEEVLLVNLCEGTFLMSVGDEKDILPPKL    281 - 350
QDDILDSLGQGINELKTAEQINEHVSGPFVQFFVKIVGHYASYIKREANGQGHFQERSFCKALTSKTNRR    351 - 420
FVKKFVKTQLFSLFIQEAEKSKNPPAGYFQQKILEYEEQKKQKKPREKTVK                       421 - 471
//

Text Mined References (15)

PMID Year Title