Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q9H693
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMH      1 - 70
PGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRP     71 - 140
PTRTSYRLLQRVCCPSAS                                                        141 - 158
//

Text Mined References (9)

PMID Year Title
18487259 2008 Fine expression profiling of full-length transcripts using a size-unbiased cDNA library prepared with the vector-capping method.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
11076863 2000 DNA cloning using in vitro site-specific recombination.