Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMH      1 - 70
PGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRP     71 - 140
PTRTSYRLLQRVCCPSAS                                                        141 - 158
//

Text Mined References (9)

PMID Year Title