Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.54
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHG      1 - 70
ADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFK     71 - 140
AEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGR    141 - 210
LEDGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQD    211 - 280
LCRIKIRQCIGLQNLKLLDELPIAKVMKDYLKHKFDDI                                    281 - 318
//

Text Mined References (12)

PMID Year Title
27697924 2016 ASB7 regulates spindle dynamics and genome integrity by targeting DDA3 for proteasomal degradation.
25416956 2014 A proteome-scale map of the human interactome network.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...