Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.94
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHG      1 - 70
ADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFK     71 - 140
AEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGR    141 - 210
LEDGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQD    211 - 280
LCRIKIRQCIGLQNLKLLDELPIAKVMKDYLKHKFDDI                                    281 - 318
//

Text Mined References (12)

PMID Year Title