Property Summary

NCBI Gene PubMed Count 36
PubMed Score 29.05
PubTator Score 18.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 2.5e-02
esophageal adenocarcinoma -1.700 1.9e-02
oligodendroglioma -1.100 3.3e-02
osteosarcoma -1.524 6.8e-06
ovarian cancer 1.600 5.7e-06
tuberculosis 1.800 1.8e-08

Gene RIF (18)

AA Sequence

MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERD      1 - 70
AFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRT     71 - 140
YREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSE    141 - 210
KAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLV    211 - 280
FQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLEL    281 - 350
LEDQSDIVSTMEHYYTAF                                                        351 - 368
//

Text Mined References (39)

PMID Year Title