Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.91
PubTator Score 2.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.2e-02

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.165 2.2e-02

Gene RIF (3)

AA Sequence

MLTQLKAKSEGKLAKQICKVVLDHFEKQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLH      1 - 70
LKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLLPVLALELRDGEKVLDLCA     71 - 140
APGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDAQPEMFDKVLV    141 - 210
DAPCSNDRSWLFSSDSQKASCRISQRRNLPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEIL    211 - 280
NSHGNIMPMDIKGIARTCSHDFTFAPTGQECGLLVIPDKGKAWGPMYVAKLKKSWSTGKW              281 - 340
//

Text Mined References (9)

PMID Year Title