Property Summary

NCBI Gene PubMed Count 11
PubMed Score 34.10
PubTator Score 11.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLV      1 - 70
PGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDR     71 - 140
LPEEKMQTQGSSNQ                                                            141 - 154
//

Text Mined References (13)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18291362 2008 Sulindac suppresses beta-catenin expression in human cancer cells.
17601797 2007 cGMP-dependent protein kinase I interacts with TRIM39R, a novel Rpp21 domain-containing TRIM protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...