Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.60
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
24127187 Loss of RERGL expression is associated with familial colorectal cancer.

AA Sequence

MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSL      1 - 70
TSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQK     71 - 140
LALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV         141 - 205
//

Text Mined References (6)

PMID Year Title
24127187 2014 Genome-wide analysis associates familial colorectal cancer with increases in copy number variations and a rare structural variation at 12p12.3.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9628821 1998 Identification of sequence-tagged transcripts differentially expressed within the human hematopoietic hierarchy.