Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.69
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.200 9.6e-03
astrocytic glioma -1.500 3.0e-02
Atopic dermatitis -1.600 6.1e-03
atypical teratoid / rhabdoid tumor -1.500 2.3e-03
Breast cancer -1.200 4.5e-07
breast carcinoma -1.200 1.1e-18
colon cancer -1.500 8.0e-06
ductal carcinoma in situ -2.100 1.1e-02
ependymoma -1.900 4.6e-02
glioblastoma multiforme -1.200 1.5e-23
group 4 medulloblastoma -1.400 2.2e-03
intraductal papillary-mucinous adenoma (... -1.200 2.8e-02
intraductal papillary-mucinous carcinoma... -1.300 2.6e-02
invasive ductal carcinoma -2.500 2.5e-02
malignant mesothelioma -1.300 2.8e-05
medulloblastoma, large-cell -1.700 8.7e-04
nephrosclerosis 1.056 7.5e-03
non diabetic and post-ischemic heart fai... 1.100 5.7e-04
osteosarcoma -3.410 7.3e-05
pituitary cancer 2.100 9.4e-08
primitive neuroectodermal tumor -1.200 1.0e-02
psoriasis -1.900 3.3e-06

Gene RIF (1)

AA Sequence

MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSL      1 - 70
TSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQK     71 - 140
LALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV         141 - 205
//

Text Mined References (6)

PMID Year Title