Property Summary

NCBI Gene PubMed Count 18
Grant Count 63
R01 Count 43
Funding $10,021,854.01
PubMed Score 143.46
PubTator Score 194.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9H611 B2RPL7 Q1W5B6 Q330H5 Q33E24
Symbols PIF
C15orf20

Gene

PDB

5FHH  

Gene RIF (13)

PMID Text
25589786 Pif1 readily unfolds a parallel quadruplex DNA substrate in a multiturnover reaction and also generates some product under single cycle conditions
25359767 Authors characterised a functional role for human PIF1 in DNA replication that becomes important for cell growth under oncogenic stress.
23924759 A minimum of 10 oligonucleotide bases are required for PIF1 binding and the hydrolysis of ATP.
23657261 when expressed in yeast, human PIF1 suppressed both G-quadruplex-associated DNA damage and telomere lengthening
23596008 the yeast ortholog of Pif1 appears to move along DNA in single nucleotide or base pair steps, powered by hydrolysis of 1 molecule of ATP.
22347400 PIF1 variant L319P was identified in three breast cancer families
21616935 Findings suggest roles for PIF1 in S-phase entry and progression that are essential to protect human tumor cells from apoptosis.
20524933 Human Pif1 could have a role in processing G4 structures that arise in the single-stranded nucleic acid intermediates formed during DNA replication and gene expression.
19700773 hPif1 specifically recognizes and unwinds DNA structures resembling putative stalled replication forks.
18835853 Evidence that the PIF1 N-terminal (PINT) domain as crucial functions in PIF1 helicase.
More...

AA Sequence

MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPGPAGRPRCFP      1 - 70
LRAARLFTRFAEAGRSTLRLPAHDTPGAGAVQLLLSDCPPDRLRRFLRTLRLKLAAAPGPGPASARAQLL     71 - 140
GPRPRDFVTISPVQPEERRLRAATRVPDTTLVKRPVEPQAGAEPSTEAPRWPLPVKRLSLPSTKPQLSEE    141 - 210
QAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAP    211 - 280
LAQCVALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQNKPFGGIQLIICGDFLQLPPV    281 - 350
TKGSQPPRFCFQSKSWKRCVPVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGI    351 - 420
VATRLCTHQDDVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQVMLVKNLSVS    421 - 490
RGLVNGARGVVVGFEAEGRGLPQVRFLCGVTEVIHADRWTVQATGGQLLSRQQLPLQLAWAMSIHKSQGM    491 - 560
TLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEA    561 - 630
ASDQENMDPIL                                                               631 - 641
//

Text Mined References (23)

PMID Year Title
25589786 2015 A parallel quadruplex DNA is bound tightly but unfolded slowly by pif1 helicase.
25359767 2014 Human PIF1 helicase supports DNA replication and cell growth under oncogenic-stress.
23924759 Determination of the biochemical properties of full-length human PIF1 ATPase.
23657261 2013 Pif1 family helicases suppress genome instability at G-quadruplex motifs.
23596008 2013 Yeast Pif1 helicase exhibits a one-base-pair stepping mechanism for unwinding duplex DNA.
23275553 2013 Alternative translation initiation augments the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22347400 2012 A genomewide screen for suppressors of Alu-mediated rearrangements reveals a role for PIF1.
21616935 2011 Suppression of apoptosis by PIF1 helicase in human tumor cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...