Property Summary

NCBI Gene PubMed Count 19
PubMed Score 156.49
PubTator Score 194.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 8.4e-06
Breast cancer 1.100 5.9e-06
glioblastoma 1.100 1.8e-06
group 3 medulloblastoma 1.800 4.9e-05
lung adenocarcinoma 1.700 8.2e-07
medulloblastoma, large-cell 1.800 5.1e-04
primitive neuroectodermal tumor 1.700 2.0e-04
psoriasis 1.700 8.9e-50

Gene RIF (14)

AA Sequence

MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPGPAGRPRCFP      1 - 70
LRAARLFTRFAEAGRSTLRLPAHDTPGAGAVQLLLSDCPPDRLRRFLRTLRLKLAAAPGPGPASARAQLL     71 - 140
GPRPRDFVTISPVQPEERRLRAATRVPDTTLVKRPVEPQAGAEPSTEAPRWPLPVKRLSLPSTKPQLSEE    141 - 210
QAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAP    211 - 280
LAQCVALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQNKPFGGIQLIICGDFLQLPPV    281 - 350
TKGSQPPRFCFQSKSWKRCVPVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGI    351 - 420
VATRLCTHQDDVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQVMLVKNLSVS    421 - 490
RGLVNGARGVVVGFEAEGRGLPQVRFLCGVTEVIHADRWTVQATGGQLLSRQQLPLQLAWAMSIHKSQGM    491 - 560
TLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEA    561 - 630
ASDQENMDPIL                                                               631 - 641
//

Text Mined References (24)

PMID Year Title