Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.83
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.617 0.000
glioblastoma 1.100 0.005
lung cancer -2.100 0.005
interstitial cystitis 1.300 0.000
lung adenocarcinoma -1.600 0.000
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
23285124 Fam124B is a novel protein possibly involved in the pathogenesis of CHARGE syndrome and neurodevelopmental disorders.

AA Sequence

MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVL      1 - 70
LFLHESPGEDRLFRVLDSLQHSPWQCYPTQDTRGRLCPYFFANQEFYSLDSQLPIWGVRQVHCGSEILRV     71 - 140
TLYCSFDNYEDAIRLYEMILQREATLQKSNFCFFVLYASKSFALQLSLKQLPPGMSVDPKESSVLQFKVQ    141 - 210
EIGQLVPLLPNPCMPISSTRWQTQDYDGNKILLQVQLNPELGVKNGILGAGMLPLGSRLTSVSAKRTSEP    211 - 280
RSQRNQGKRSQGHSLELPEPSGSPTSDRCAGTSWKSPGRSFQVSSPAMGAHLHLSSHHLESGARMKVLNR    281 - 350
ENSFQKLEAETNVDTGLTIINSEPRQTYFGGFPRDLQTSQPPFCLPASSLGVATSKNNSVLKERVSPLPL    351 - 420
AGQRDLGTRKTISECLLHLQVQGEEKEEDEEEFFI                                       421 - 455
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23285124 2012 Identification and characterization of FAM124B as a novel component of a CHD7 and CHD8 containing complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...