Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.40
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 2.671 6.0e-03
Atopic dermatitis -1.100 1.7e-03
atypical teratoid / rhabdoid tumor 1.500 4.0e-02
cystic fibrosis -1.200 1.5e-03
fibroadenoma 1.200 4.8e-02
group 3 medulloblastoma 1.700 2.0e-02
interstitial cystitis -3.800 2.5e-04
intraductal papillary-mucinous adenoma (... 2.500 6.3e-03
lung carcinoma 1.300 2.4e-02
non diabetic and post-ischemic heart fai... 1.400 2.5e-03
non-small cell lung cancer 1.007 5.0e-03
ovarian cancer -1.900 5.8e-05
psoriasis -1.200 9.6e-08
spina bifida -1.789 4.4e-02

Gene RIF (2)

AA Sequence

MKLWIHLFYSSLLACISLHSQTPVLSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLS      1 - 70
LLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEF     71 - 140
LQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRI    141 - 210
LDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPS    211 - 280
GSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQER    281 - 350
NIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG    351 - 420
NHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLK    421 - 490
TNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKAL    491 - 560
NSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLSVLILGLLIMFITIVFCAAGIVV    561 - 630
LVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHL    631 - 700
EEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLG    701 - 770
ITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ    771 - 840
T//

Text Mined References (13)

PMID Year Title