Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.90
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
group 3 medulloblastoma 1.800 0.010
non diabetic and post-ischemic heart fai... 1.400 0.002
atypical teratoid / rhabdoid tumor 1.500 0.040
Atopic dermatitis -1.100 0.002
non-small cell lung cancer 1.167 0.004
intraductal papillary-mucinous adenoma (... 2.900 0.005
active Crohn's disease 3.172 0.006
fibroadenoma 1.200 0.048
interstitial cystitis -4.800 0.000
cystic fibrosis -1.300 0.001
psoriasis -1.400 0.000
lung carcinoma 1.300 0.024
spina bifida -1.789 0.044
ovarian cancer -1.900 0.000

Synonym

Accession Q9H5Y7 A8K9S8 Q495Q0 Q6AW93 Q9HAA8 Q9NT60
Symbols DFNMYP

Gene

Gene RIF (2)

PMID Text
23946138 SLITRK6 gene nonsense mutation is associated with progressive auditory neuropathy in humans.
23543054 SLITRK6 plays a crucial role in the development of normal hearing as well as vision in humans and in mice and that its disruption leads to a syndrome characterized by severe myopia and deafness.

AA Sequence

MKLWIHLFYSSLLACISLHSQTPVLSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLS      1 - 70
LLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEF     71 - 140
LQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRI    141 - 210
LDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPS    211 - 280
GSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQER    281 - 350
NIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG    351 - 420
NHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLK    421 - 490
TNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKAL    491 - 560
NSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLSVLILGLLIMFITIVFCAAGIVV    561 - 630
LVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHL    631 - 700
EEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLG    701 - 770
ITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ    771 - 840
T//

Text Mined References (13)

PMID Year Title
23946138 2014 A homozygous SLITRK6 nonsense mutation is associated with progressive auditory neuropathy in humans.
23543054 2013 SLITRK6 mutations cause myopia and deafness in humans and mice.
23326512 2013 Genome-wide association study of irritable vs. elated mania suggests genetic differences between clinical subtypes of bipolar disorder.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
More...