Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.87
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 4.1e-08
glioblastoma 1.100 6.4e-08
invasive ductal carcinoma 1.282 3.9e-02
ovarian cancer -1.300 1.6e-03
pancreatic ductal adenocarcinoma liver m... -2.200 8.3e-03
pediatric high grade glioma 1.300 1.3e-07

Gene RIF (4)

AA Sequence

MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQ      1 - 70
EINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVA     71 - 140
AAMENPNLREIVEQCVLEPD                                                      141 - 160
//

Text Mined References (13)

PMID Year Title