Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.54
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9H5X1 A6NKS1 B2R5F8 B7Z8Z5
Symbols CIA2A

Gene

PDB

2M5H   3UX2   3UX3  

Gene RIF (3)

PMID Text
25716227 FAM96A expression was much reduced in tumorigenic ICC-SCs.
23891004 CIA2B-CIA1-MMS19 and CIA2A-CIA1 assist different branches of Fe/S protein assembly and intimately link this process to cellular iron regulation via IRP1 Fe/S cluster maturation and IRP2 stabilization.
22683786 putative metal-binding site of bacterial DUF59 proteins is not conserved in Fam96a, but Fam96a interacts tightly in vitro with Ciao1, the cytosolic iron-assembly protein

AA Sequence

MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQ      1 - 70
EINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVA     71 - 140
AAMENPNLREIVEQCVLEPD                                                      141 - 160
//

Text Mined References (12)

PMID Year Title
25716227 2015 FAM96A is a novel pro-apoptotic tumor suppressor in gastrointestinal stromal tumors.
25416956 2014 A proteome-scale map of the human interactome network.
23891004 2013 Human CIA2A-FAM96A and CIA2B-FAM96B integrate iron homeostasis and maturation of different subsets of cytosolic-nuclear iron-sulfur proteins.
22683786 2012 The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer.
21269460 2011 Initial characterization of the human central proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...