Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 6.48652956665393E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00124731538631653
astrocytic glioma 2241 0.00817602484086831
ependymoma 2514 0.0236385929923536

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.400 0.008
ependymoma -1.200 0.024
intraductal papillary-mucinous neoplasm ... 1.400 0.001

Synonym

Accession Q9H5V9 A8MPX7 B4DQN2 D3DWH9 F5GWL7 O43351
Symbols

Gene

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN      1 - 70
TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK     71 - 140
KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA    141 - 210
KMKGTLIDNQFK                                                              211 - 222
//

Text Mined References (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.