Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.400 8.2e-03
ependymoma -1.200 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.2e-03
malignant mesothelioma 1.100 6.5e-06

Synonym

Accession Q9H5V9 A8MPX7 B4DQN2 D3DWH9 F5GWL7 O43351
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN      1 - 70
TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK     71 - 140
KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA    141 - 210
KMKGTLIDNQFK                                                              211 - 222
//

Text Mined References (9)

PMID Year Title