Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.400 0.008
ependymoma -1.200 0.024
intraductal papillary-mucinous neoplasm ... 1.400 0.001

AA Sequence

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN      1 - 70
TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK     71 - 140
KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA    141 - 210
KMKGTLIDNQFK                                                              211 - 222
//

Text Mined References (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.