Property Summary

NCBI Gene PubMed Count 64
Grant Count 16
R01 Count 15
Funding $1,600,710.94
PubMed Score 59.92
PubTator Score 89.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (49)

PMID Text
26882065 Elevated CDCP1 was observed in 77% of HGSC cases. Silencing of CDCP1 reduced migration and non-adherent cell growth in vitro and tumour burden in vivo.
26553452 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis
26497208 Our results establish that differential glycosylation, cell surface presentation and extracellular expression of CDCP1 are hallmarks of prostate cancer progression.
25893298 CDCP1 protein plays an important role in the progression of ovarian clear cell carcinoma. Elevated CDCP1 levels correlates with poor patient outcome in ovarian clear cell carcinoma patients.
25892239 CDCP1 overexpression enhances HER2 activity. CDCP1 binds to HER2, promoting SRC-HER2 crosstalk.
25820997 High CDCP1 expression is associated with Colorectal Cancer.
25775948 The aim of this study was to examine whether activation of Trask may be potentially important in brain metastasis of lung cancers, the commonest site of organ spread and producing the deadliest consequences.
25728678 Multiple tyrosine phosphorylation sites of CDCP1 are important for the functional regulation of SFKs in several tumor types.
25301083 CDCP1 modulates cell-substratum adhesion and motility in colon cancer cell lines.
25275584 These data suggest CDCP1 expression can be used to identify a subset of marrow fibroblasts functionally distinct from CD146+ fibroblasts.
More...

AA Sequence

MAGLNCGVSIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVISKRHITMLSI      1 - 70
KSGERIVFTFSCQSPENHFVIEIQKNIDCMSGPCPFGEVQLQPSTSLLPTLNRTFIWDVKAHKSIGLELQ     71 - 140
FSIPRLRQIGPGESCPDGVTHSISGRIDATVVRIGTFCSNGTVSRIKMQEGVKMALHLPWFHPRNVSGFS    141 - 210
IANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEER    211 - 280
VEYYIPGSTTNPEVFKLEDKQPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLS    281 - 350
NERAMSLTIEPRPVKQSRKFVPGCFVCLESRTCSSNLTLTSGSKHKISFLCDDLTRLWMNVEKTISCTDH    351 - 420
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPS    421 - 490
QDLYFGSFCPGGSIKQIQVKQNISVTLRTFAPSFQQEASRQGLTVSFIPYFKEEGVFTVTPDTKSKVYLR    491 - 560
TPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERSGVVCQTGRAFMIIQEQRTRAEEIFSLDEDVLPKPS    561 - 630
FHHHSFWVNISNCSPTSGKQLDLLFSVTLTPRTVDLTVILIAAVGGGVLLLSALGLIICCVKKKKKKTNK    631 - 700
GPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVIEDTMVYGHLLQDSSGSFLQPEVDTYRPFQGTMG    701 - 770
VCPPSPPTICSRAPTAKLATEEPPPRSPPESESEPYTFSHPNNGDVSSKDTDIPLLNTQEPMEPAE        771 - 836
//

Text Mined References (66)

PMID Year Title
26882065 2016 Cell line and patient-derived xenograft models reveal elevated CDCP1 as a target in high-grade serous ovarian cancer.
26782745 2016 Efficient construct of a large and functional scFv yeast display library derived from the ascites B cells of ovarian cancer patients by three-fragment transformation-associated recombination.
26553452 2015 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis.
26497208 2015 Dysregulated expression of cell surface glycoprotein CDCP1 in prostate cancer.
25893298 2016 Elevated CDCP1 predicts poor patient outcome and mediates ovarian clear cell carcinoma by promoting tumor spheroid formation, cell migration and chemoresistance.
25892239 2015 Interaction of CDCP1 with HER2 enhances HER2-driven tumorigenesis and promotes trastuzumab resistance in breast cancer.
25820997 2015 Prognostic Significance of CDCP1 Expression in Colorectal Cancer and Effect of Its Inhibition on Invasion and Migration.
25775948 2015 Significance of Trask protein interactions in brain metastatic cohorts of lung cancers.
25728678 2015 CUB-domain-containing protein 1 overexpression in solid cancers promotes cancer cell growth by activating Src family kinases.
25416956 2014 A proteome-scale map of the human interactome network.
More...