Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 3.364 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.300 7.6e-05
lung cancer 1.200 1.1e-02
medulloblastoma, large-cell 1.200 8.8e-04
primitive neuroectodermal tumor 1.100 1.3e-03
psoriasis -1.300 5.8e-04

AA Sequence

MAASRNGFEAVEAEGSAGCRGSSGMEVVLPLDPAVPAPLCPHGPTLLFVKVTQGKEETRRFYACSACRDR      1 - 70
KDCNFFQWEDEKLSGARLAAREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQTCQQLLLPDDWGQH     71 - 140
SEHQVLGNVSITQLRRPSQLLYPLENKKTNAQYLFADRSCQFLVDLLSALGFRRVLCVGTPRLHELIKLT    141 - 210
ASGDKKSNIKSLLLDIDFRYSQFYMEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMVTDPPFG    211 - 280
GLVEPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQMLDYQVDYDNHALYKHGK    281 - 350
TGRKQSPVRIFTNIPPNKIILPTEEGYRFCSPCQRYVSLENQHCELCNSCTSKDGRKWNHCFLCKKCVKP    351 - 420
SWIHCSICNHCAVPDHSCEGPKHGCFICGELDHKRSTCPNIATSKRANKAVRKQKQRKSNKMKMETTKGQ    421 - 490
SMNHTSATRRKKRRERAHQYLGS                                                   491 - 513
//

Text Mined References (6)

PMID Year Title