Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.86
PubTator Score 18.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
glioblastoma multiforme 347 7.66178496328559E-15
ovarian cancer 8492 1.84190689282648E-9
osteosarcoma 7933 8.22633654025518E-8
medulloblastoma, large-cell 6234 1.15588416506262E-5
psoriasis 6685 2.30753250735878E-5
ductal carcinoma in situ 1745 1.88514478758732E-4
lung cancer 4473 0.00188648833483048
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0029956482447527
subependymal giant cell astrocytoma 2287 0.00683900485465621
invasive ductal carcinoma 2950 0.0126133303106725
non primary Sjogren syndrome sicca 840 0.0264535981808959
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Nephronophthisis 74 3.441 1.7
Ciliopathy 57 3.054 1.5

Expression

  Differential Expression (11)

Synonym

Accession Q9H5N1
Symbols FRA

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
17254320 FRA-1 expression, including its intracellular localization, may be considered a useful marker for hyperplastic and neoplastic proliferative breast disorders
17205062 Pyk2 regulation is associated with increased expression of Fra-1 and JunD, activator protein-1 transcription factors known to be required for involucrin expression.

AA Sequence

MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAE      1 - 70
AVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEK     71 - 140
QMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPL    141 - 210
EELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLP    211 - 280
PPGYQLVPDTQWEQLQTEGRQLQKDLESVSRERDELQEGLRRSNEDCAKQMQVLLAQVQNSEQLLRTLQG    281 - 350
TVSQAQERVQLQMAELVTTHKCLHHEVKRLNEENQGLRAEQLPSSAPQGSQQEQGEEESLPSSVPELQQL    351 - 420
LCCTRQEARARLQAQEHGAERLRIEIVTLREALEEETVARASLEGQLRVQREETEVLEASLCSLRTEMER    421 - 490
VQQEQSKAQLPDLLSEQRAKVLRLQAELETSEQVQRDFVRLSQALQVRLERIRQAETLEQVRSIMDEAPL    491 - 560
TDVRDIKDT                                                                 561 - 569
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
17254320 2007 FRA-1 protein overexpression is a feature of hyperplastic and neoplastic breast disorders.
17205062 2007 The role of proline-rich protein tyrosine kinase 2 in differentiation-dependent signaling in human epidermal keratinocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...