Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.71
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ductal carcinoma in situ 1.400 1.9e-04
glioblastoma multiforme 1.100 7.7e-15
invasive ductal carcinoma 1.200 1.3e-02
lung cancer 1.800 1.9e-03
medulloblastoma, large-cell 1.100 1.2e-05
non primary Sjogren syndrome sicca 1.100 2.6e-02
osteosarcoma 1.617 8.2e-08
ovarian cancer 3.100 1.8e-09
pancreatic ductal adenocarcinoma liver m... 1.150 3.0e-03
psoriasis 1.300 2.6e-03
subependymal giant cell astrocytoma 2.053 6.8e-03

Gene RIF (2)

AA Sequence

MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAE      1 - 70
AVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEK     71 - 140
QMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPL    141 - 210
EELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLP    211 - 280
PPGYQLVPDTQWEQLQTEGRQLQKDLESVSRERDELQEGLRRSNEDCAKQMQVLLAQVQNSEQLLRTLQG    281 - 350
TVSQAQERVQLQMAELVTTHKCLHHEVKRLNEENQGLRAEQLPSSAPQGSQQEQGEEESLPSSVPELQQL    351 - 420
LCCTRQEARARLQAQEHGAERLRIEIVTLREALEEETVARASLEGQLRVQREETEVLEASLCSLRTEMER    421 - 490
VQQEQSKAQLPDLLSEQRAKVLRLQAELETSEQVQRDFVRLSQALQVRLERIRQAETLEQVRSIMDEAPL    491 - 560
TDVRDIKDT                                                                 561 - 569
//

Text Mined References (12)

PMID Year Title