Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGITPWPKGHTEPKGSYSLRKKPCYGTVAALDCAGCQEGMAEAASVGLAQSESTTIMGHVCAERHTHDRY      1 - 70
VTSMCPYLPLPMDGNAMDFSFLSSARAKQFFTVFSRSSSHLSAPQTGLLQWITNLAGRPWPALTAASGAG     71 - 140
MKQKQ                                                                     141 - 145
//

Text Mined References (10)

PMID Year Title
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
18391951 2008 Many sequence variants affecting diversity of adult human height.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.