Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGITPWPKGHTEPKGSYSLRKKPCYGTVAALDCAGCQEGMAEAASVGLAQSESTTIMGHVCAERHTHDRY      1 - 70
VTSMCPYLPLPMDGNAMDFSFLSSARAKQFFTVFSRSSSHLSAPQTGLLQWITNLAGRPWPALTAASGAG     71 - 140
MKQKQ                                                                     141 - 145
//

Text Mined References (10)

PMID Year Title