Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.49
PubTator Score 2.67

Knowledge Summary

Patent (161)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.378 5.9e-06
ovarian cancer 1.600 3.0e-12

Gene RIF (3)

AA Sequence

MEKQPQNSRRGLAPREVPPAVGLLLIMALMNTLLYLCLDHFFIAPRQSTVDPTHCPYGHFRIGQMKNCSP      1 - 70
WLSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGLQMLKSLQGTHVVTLLGY     71 - 140
CEDDNTMLTEYHPLGSLSNLEETLNLSKYQNVNTWQHRLELAMDYVSIINYLHHSPVGTRVMCDSNDLPK    141 - 210
TLSQYLLTSNFSILANDLDALPLVNHSSGMLVKCGHRELHGDFVAPEQLWPYGEDVPFHDDLMPSYDEKI    211 - 280
DIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML    281 - 350
//

Text Mined References (16)

PMID Year Title