Property Summary

NCBI Gene PubMed Count 23
Grant Count 119
R01 Count 56
Funding $28,603,327.4
PubMed Score 216.42
PubTator Score 52.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H5J4 Q4W5L0 Q8NCD1
Symbols FAE
LCE
FACE

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
25794162 ). In conclusion, we found an interaction between the HLA-Cw6 and LCE genotypes on disease improvement among psoriatic patients treated with anti-TNFs.
25003994 KAR regulates ELOVL6 via two modes; KAR may induce conformational changes in ELOVL6; conversion of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA by KAR may facilitate release of the product from the ELOVL6-KAR complex.
24714086 human liver samples from patients with Non-alcoholic steatohepatitis or Non-alcoholic steatohepatitis-related hepatocellular carcinoma showed an elevated expression of the elongase ELOVL6, which is responsible for the elongation of C16 fatty acids.
24113622 Elovl6 expression is significantly downregulated in human lung with idiopathic pulmonary fibrosis.
23903678 The study indicated that the ELOVL6 gene polymorphism rs12504538 is associated with an increased risk of T2DM, because it causes an increase in insulin resistance.
22753171 Elovl6 expression is positively correlated with severity of hepatosteatosis and liver injury in NASH patients.
21701577 Genetic variations in the ELOVL6 gene were associated with insulin sensitivity in this population-based study.
21544602 study showed cystic fibrosis cells exhibit increased metabolism along metabolic pathways leading to n-7 and n-9 fatty acids compared with wild-type cells; changes are accompanied by increased expression of Delta5, Delta6 and Delta9 desaturases and elongases 5 and 6
20332099 Observational study of gene-disease association. (HuGE Navigator)
19259639 Studies suggest that inhibition of ELOVL6 could be a new therapeutic approach for the treatment of insulin resistance, diabetes, cardiovascular disease, and other metabolic diseases.
More...

AA Sequence

MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTL      1 - 70
AVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFL     71 - 140
HWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGC    141 - 210
VVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE                   211 - 265
//

Text Mined References (23)

PMID Year Title
25794162 2015 The Cw6 and late-cornified envelope genotype plays a significant role in anti-tumor necrosis factor response among psoriatic patients.
25003994 2014 Two modes of regulation of the fatty acid elongase ELOVL6 by the 3-ketoacyl-CoA reductase KAR in the fatty acid elongation cycle.
24714086 2014 Fatty acid elongation in non-alcoholic steatohepatitis and hepatocellular carcinoma.
24113622 2013 Deranged fatty acid composition causes pulmonary fibrosis in Elovl6-deficient mice.
23903678 2013 Genetic analysis of the ELOVL6 gene polymorphism associated with type 2 diabetes mellitus.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22753171 2012 Elovl6 promotes nonalcoholic steatohepatitis.
21701577 2011 ELOVL6 genetic variation is related to insulin sensitivity: a new candidate gene in energy metabolism.
21544602 2011 Increased elongase 6 and ?9-desaturase activity are associated with n-7 and n-9 fatty acid changes in cystic fibrosis.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
More...