Property Summary

Ligand Count 78
NCBI Gene PubMed Count 25
PubMed Score 74.14
PubTator Score 52.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.092 2.3e-02
acute myeloid leukemia -1.400 1.3e-02
adult high grade glioma -1.500 1.6e-06
aldosterone-producing adenoma -1.270 4.2e-02
astrocytic glioma -1.800 1.8e-02
atypical teratoid / rhabdoid tumor 1.100 1.7e-02
Breast cancer 1.700 5.1e-07
cystic fibrosis 1.023 1.2e-04
ependymoma -1.800 4.2e-02
gastric cancer 1.400 4.7e-04
glioblastoma -1.400 6.6e-05
group 3 medulloblastoma -1.300 5.7e-03
hepatocellular carcinoma 1.500 8.0e-05
interstitial cystitis -2.200 3.6e-03
intraductal papillary-mucinous adenoma (... 2.700 1.7e-03
intraductal papillary-mucinous carcinoma... 3.300 3.0e-03
intraductal papillary-mucinous neoplasm ... 3.800 1.9e-03
lung cancer 2.200 9.8e-04
lung carcinoma 1.500 3.4e-23
medulloblastoma, large-cell -1.600 3.4e-04
non diabetic and post-ischemic heart fai... -1.700 1.8e-02
non-small cell lung cancer 1.605 1.3e-12
oligodendroglioma -1.400 1.6e-02
osteosarcoma -2.426 1.9e-05
pancreatic cancer 1.700 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.597 1.8e-04
psoriasis -1.200 6.4e-04
tuberculosis 1.200 2.2e-04

Gene RIF (13)

AA Sequence

MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTL      1 - 70
AVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFL     71 - 140
HWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGC    141 - 210
VVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE                   211 - 265
//

Text Mined References (25)

PMID Year Title