Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
R01 Count 6
Funding $768,093.67
PubMed Score 18.49
PubTator Score 15.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (8)

PMID Text
26183527 Our results reveal the regulatory mechanism of LSD1 protein through its lysine methylation by SUV39H2 in human cancer cells
25459750 We also demonstrate that the N324K mutant in the SET domain of SUV39H2 that has been shown to cause an inherited nasal skin disease in Labrador Retrievers renders SUV39H2 inactive
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
21896933 genetic association studies in a Finnish population with type I diabetes: The minor T allele of exonic SNP rs17353856 in SUV39H2 is associated with diabetic retinopathy (in a larger meta-analysis); thus an genetic variation may be protective.
21402781 findings suggest that Suv39H1 and Suv39H2 are key hypoxia-induced methyltransferases; their decline in fetal lung during late gestation is critical for epigenetic changes resulting in the developmental induction of SP-A
18231586 The SUV39H2 gene is found in tetrapods (e.g., human, mouse and frog) but not in zebrafish, suggesting that this gene is generated by a tetrapod lineage-specific gene duplication event.
16774942 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16774942 a novel SUV39H2 polymorphism may have a role in lung cancer susceptibility for smokers

AA Sequence

MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKDMEYYLVKWKG      1 - 70
WPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRW     71 - 140
QDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLL    141 - 210
AYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEY    211 - 280
VGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTR    281 - 350
LPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN              351 - 410
//

Text Mined References (29)

PMID Year Title
26183527 2015 SUV39H2 methylates and stabilizes LSD1 by inhibiting polyubiquitination in human cancer cells.
25459750 2015 Activity and specificity of the human SUV39H2 protein lysine methyltransferase.
25416956 2014 A proteome-scale map of the human interactome network.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21896933 2011 Genetic examination of SETD7 and SUV39H1/H2 methyltransferases and the risk of diabetes complications in patients with type 1 diabetes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21402781 2011 Epigenetic regulation of surfactant protein A gene (SP-A) expression in fetal lung reveals a critical role for Suv39h methyltransferases during development and hypoxia.
More...