Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.12
PubTator Score 15.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.6e-05
Breast cancer 1.300 1.6e-06
group 3 medulloblastoma 1.600 7.2e-04
invasive ductal carcinoma 1.700 1.8e-02
lung cancer 1.300 1.9e-02
lung carcinoma 1.100 2.6e-25
malignant mesothelioma 1.100 8.0e-06
medulloblastoma, large-cell 1.400 3.6e-06
nasopharyngeal carcinoma 1.300 1.6e-03
non-small cell lung cancer 1.681 2.3e-21
ovarian cancer 1.100 1.1e-03
primitive neuroectodermal tumor 1.500 1.2e-05

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (13)

AA Sequence

MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKDMEYYLVKWKG      1 - 70
WPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRW     71 - 140
QDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLL    141 - 210
AYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEY    211 - 280
VGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTR    281 - 350
LPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN              351 - 410
//

Text Mined References (34)

PMID Year Title