Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.30
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.100 2.1e-03
lung carcinoma 1.100 9.3e-20
medulloblastoma, large-cell 1.100 2.9e-02
ovarian cancer 1.200 9.2e-04

Synonym

Accession Q9H5F2 Q6I9X7 Q9NQC6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

AA Sequence

MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLM      1 - 70
GNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEK     71 - 140
STYMNSYSKP                                                                141 - 150
//

Text Mined References (7)

PMID Year Title