Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.30
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.029
interstitial cystitis -1.400 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.200 0.001

AA Sequence

MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLM      1 - 70
GNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEK     71 - 140
STYMNSYSKP                                                                141 - 150
//

Text Mined References (7)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10873569 2000 Characterization of five novel human genes in the 11q13-q22 region.