Property Summary

NCBI Gene PubMed Count 16
PubMed Score 332.51
PubTator Score 45.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.79911899503447E-20
oligodendroglioma 2849 4.01331111525488E-20
atypical teratoid / rhabdoid tumor 4369 2.79291924065897E-17
medulloblastoma 1524 1.16339216818505E-16
pilocytic astrocytoma 3086 1.96347827748315E-12
psoriasis 6685 3.50796811316609E-11
pediatric high grade glioma 2712 1.14688190469448E-8
medulloblastoma, large-cell 6234 1.31264707181619E-8
glioblastoma 5572 2.52591272454006E-8
pituitary cancer 1972 1.86523566187864E-7
astrocytic glioma 2241 0.00364405652093729
Disease Target Count Z-score Confidence
Epilepsy 346 3.824 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.100 0.004
posterior fossa group A ependymoma -3.500 0.000
oligodendroglioma -2.100 0.000
glioblastoma -3.600 0.000
medulloblastoma -4.000 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -4.100 0.000
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -3.500 0.000
pituitary cancer 3.100 0.000
psoriasis 3.300 0.000

Synonym

Accession Q9H598 Q8N489
Symbols VGAT
VIAAT

Gene

PANTHER Protein Class (2)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (5)

PMID Text
22510271 Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
21396926 We examined the ratio of excitatory to inhibitory vesicular neurotransmitter transporter mRNAs (VGluT1 to VGAT) and their ratio in the dorsolateral prefrontal cortex during normal human development and in people with schizophrenia
19874574 Observational study of gene-disease association. (HuGE Navigator)
17471287 Subjects with schizophrenia exhibited expression deficits in GABA transpter 1.
12115694 VIATT has been identified in horizontal cells of the adult outer retina in culture, either at their terminals or throughout the entire cell.

AA Sequence

MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPC      1 - 70
GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYA     71 - 140
ILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQ    141 - 210
IIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINIL    211 - 280
VIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVL    281 - 350
KGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA    351 - 420
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQV    421 - 490
FFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED                                       491 - 525
//

Text Mined References (17)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
22510271 2012 Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
21396926 2011 Expression of VGluT1 and VGAT mRNAs in human dorsolateral prefrontal cortex during development and in schizophrenia.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19843525 2009 Vesicular inhibitory amino acid transporter is a Cl-/gamma-aminobutyrate Co-transporter.
17471287 2008 Alterations in GABA-related transcriptome in the dorsolateral prefrontal cortex of subjects with schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12806177 2003 Evidence for a GABAergic system in rodent and human testis: local GABA production and GABA receptors.
More...