Property Summary

NCBI Gene PubMed Count 16
PubMed Score 352.57
PubTator Score 45.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.900 9.3e-06
astrocytic glioma -2.100 3.6e-03
Astrocytoma, Pilocytic -3.400 3.4e-12
atypical teratoid / rhabdoid tumor -3.900 2.8e-17
ependymoma -2.300 4.4e-03
glioblastoma -2.900 1.1e-11
group 3 medulloblastoma -3.400 5.5e-06
medulloblastoma, large-cell -4.100 1.3e-08
oligodendroglioma -1.800 1.6e-02
pituitary cancer 3.100 1.9e-07
psoriasis 3.300 3.5e-11

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPC      1 - 70
GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYA     71 - 140
ILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQ    141 - 210
IIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINIL    211 - 280
VIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVL    281 - 350
KGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA    351 - 420
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQV    421 - 490
FFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED                                       491 - 525
//

Text Mined References (17)

PMID Year Title