Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.06
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
23929653 DUSP21 plays an important role in sustaining hepatocellular carcinoma (HCC) cell proliferation and may thus act as a potential therapeutic target in HCC treatment.

AA Sequence

MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIK      1 - 70
VPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRR     71 - 140
PIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRMMISM                        141 - 190
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23929653 2014 RNA interference against cancer/testis genes identifies dual specificity phosphatase 21 as a potential therapeutic target in human hepatocellular carcinoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408986 2002 Identification and characterization of two novel low-molecular-weight dual specificity phosphatases.