Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.13
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 2.1e-09
psoriasis 6694 4.5e-09
osteosarcoma 7950 4.8e-05
ovarian cancer 8520 2.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 7.200 2.1e-09
osteosarcoma 1.317 4.8e-05
ovarian cancer -1.100 2.9e-04
psoriasis 1.900 4.5e-09

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG      1 - 70
RILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYAS     71 - 140
GLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMN    141 - 210
KCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESV    211 - 280
ESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTY    281 - 350
QSEWMSREEYGEHMRM                                                          351 - 366
//

Text Mined References (9)

PMID Year Title