Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession Q9H560 A8K853 Q17RD3
Symbols ANKRD19
bA526D8.2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MRKLFSFGRRLGQALLDSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDARDRKDRT      1 - 70
VLHLTCAHGRVEVVTLLLSRRCQINIYDRLNRTPLMKAVHCQEEACAIILLEHGANPNIKDIYSNTALHY     71 - 140
AVYNKGTSLAEKLLSHHANIEALNEEGNTPLLFAINSRRQQIVEFLLKNQANLHAIDNFRRTALMLAVQH    141 - 210
NSSSIVSLLLQQNINIFSQDLFGQTAEDYAVCYNFRSIQQQILEHKNKILKSHL                    211 - 264
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.