Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.7e-13

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.294 3.7e-13

Synonym

Accession Q9H560 A8K853 Q17RD3
Symbols ANKRD19
bA526D8.2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MRKLFSFGRRLGQALLDSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDARDRKDRT      1 - 70
VLHLTCAHGRVEVVTLLLSRRCQINIYDRLNRTPLMKAVHCQEEACAIILLEHGANPNIKDIYSNTALHY     71 - 140
AVYNKGTSLAEKLLSHHANIEALNEEGNTPLLFAINSRRQQIVEFLLKNQANLHAIDNFRRTALMLAVQH    141 - 210
NSSSIVSLLLQQNINIFSQDLFGQTAEDYAVCYNFRSIQQQILEHKNKILKSHL                    211 - 264
//

Text Mined References (4)

PMID Year Title