Property Summary

NCBI Gene PubMed Count 35
Grant Count 27
R01 Count 4
Funding $2,872,654.71
PubMed Score 17.27
PubTator Score 63.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.148 0.000
tuberculosis and treatment for 3 months -1.400 0.000
ovarian cancer -2.100 0.000

Gene RIF (17)

PMID Text
25667979 Results show the crystal structure of the complex between ALG-2 and a peptide of Sec31A and found that the peptide binds to the third hydrophobic pocket (Pocket 3) and that ALG-2 recognizing 2 types of motifs at different hydrophobic surfaces of Sec31A.
25534348 Lack of ALG-2, ALIX or Vps4B each prevents shedding, and repair of the injured cell membrane
25006245 ALG-2/Sec31A interactions were not required for the localization of Sec31A to ER exit sites per se but appeared to acutely regulate the stability and trafficking of the cargo receptor p24 and the distribution of the vesicle tether protein p115
24069399 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23924735 The results of in vitro binding assays using purified recombinant proteins indicated that ALG-2 functions as a Ca(2)-dependent adaptor protein that bridges ALIX and ESCRT-I to form a ternary complex
23404334 We identify ALG14 and ALG2 as novel genes in which mutations cause a congenital myasthenic syndrome
22437941 This is the first report showing interaction of ALG-2 with a P-body component (PATL1).PATL1 as well as DCP1A, a well-known P-body marker, co-localized with a subset of ALG-2.
20834162 the alg2 binding site is one of the key determinants of the retention kinetics of Sec31A at endoplasmic reticulum exit sites
20691033 inability of the two-residue shorter ALG-2 isoform to bind Alix
20571937 found that targeting Requiem and Alg-2 did not result in extended culture viability, but resulted in an increase in maximum viable cell numbers and cumulative IVCD under fed-batch conditions
More...

AA Sequence

MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRC      1 - 70
AGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFP     71 - 140
DLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDS    141 - 210
VVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEH    211 - 280
YQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPL    281 - 350
ESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV        351 - 416
//

Text Mined References (34)

PMID Year Title
25667979 2015 Structural analysis of the complex between penta-EF-hand ALG-2 protein and Sec31A peptide reveals a novel target recognition mechanism of ALG-2.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25006245 2014 Apoptosis-linked gene-2 (ALG-2)/Sec31 interactions regulate endoplasmic reticulum (ER)-to-Golgi transport: a potential effector pathway for luminal calcium.
24069399 2013 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23874384 2013 Genetics of callous-unemotional behavior in children.
23404334 2013 Congenital myasthenic syndromes due to mutations in ALG2 and ALG14.
22437941 2012 Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
21269460 2011 Initial characterization of the human central proteome.
20834162 2010 The ALG-2 binding site in Sec31A influences the retention kinetics of Sec31A at the endoplasmic reticulum exit sites as revealed by live-cell time-lapse imaging.
More...