Knowledge Summary

Patent

No data available

Synonym

Accession Q9H521
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVWQENEDLRKQLVEASELLKSQAKELKDAHQQQKLALQDFLELCELVAELCSQKQKVWDKEGEMEVAMQ      1 - 70
KVNTMWQES                                                                  71 - 79
//

Text Mined References (1)

PMID Year Title
15057823 2004 The DNA sequence and analysis of human chromosome 13.